DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and GRXC1

DIOPT Version :10

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_568962.1 Gene:GRXC1 / 836423 AraportID:AT5G63030 Length:125 Species:Arabidopsis thaliana


Alignment Length:86 Identity:36/86 - (41%)
Similarity:49/86 - (56%) Gaps:0/86 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RDTISGNKVVIFSKSYCPYCSMAKEQFRKINVKATVIELDQRDDGNEIQAVLGEMTGSRTVPRCF 90
            ::.:|...||:|||:||.||...|:...::.....|:|||:..||.|||:.|.|.||..|||..|
plant    23 KEIVSAYPVVVFSKTYCGYCQRVKQLLTQLGATFKVLELDEMSDGGEIQSALSEWTGQTTVPNVF 87

  Fly    91 IDGKFVGGGTDVKRLYEQGIL 111
            |.|..:||...|....:||.|
plant    88 IKGNHIGGCDRVMETNKQGKL 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 35/79 (44%)
GRXC1NP_568962.1 GRX_GRXh_1_2_like 30..111 CDD:239511 35/79 (44%)

Return to query results.
Submit another query.