DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and GRXC2

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001119339.1 Gene:GRXC2 / 834035 AraportID:AT5G40370 Length:136 Species:Arabidopsis thaliana


Alignment Length:81 Identity:36/81 - (44%)
Similarity:47/81 - (58%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GNKVVIFSKSYCPYCSMAKEQFRKINVKATVIELDQRDDGNEIQAVLGEMTGSRTVPRCFIDGKF 95
            ||...|.||:|||||...||..:::..|...:|||...||::||:.|.|.||.||||..||.|..
plant    37 GNFSGICSKTYCPYCVRVKELLQQLGAKFKAVELDTESDGSQIQSGLAEWTGQRTVPNVFIGGNH 101

  Fly    96 VGGGTDVKRLYEQGIL 111
            :||......|::.|.|
plant   102 IGGCDATSNLHKDGKL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 34/79 (43%)
GRXC2NP_001119339.1 GRX_GRXh_1_2_like 42..120 CDD:239511 34/76 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53522
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 1 1.000 - - FOG0000858
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100315
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X228
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.690

Return to query results.
Submit another query.