DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and GRXC2

DIOPT Version :10

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001119339.1 Gene:GRXC2 / 834035 AraportID:AT5G40370 Length:136 Species:Arabidopsis thaliana


Alignment Length:81 Identity:36/81 - (44%)
Similarity:47/81 - (58%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GNKVVIFSKSYCPYCSMAKEQFRKINVKATVIELDQRDDGNEIQAVLGEMTGSRTVPRCFIDGKF 95
            ||...|.||:|||||...||..:::..|...:|||...||::||:.|.|.||.||||..||.|..
plant    37 GNFSGICSKTYCPYCVRVKELLQQLGAKFKAVELDTESDGSQIQSGLAEWTGQRTVPNVFIGGNH 101

  Fly    96 VGGGTDVKRLYEQGIL 111
            :||......|::.|.|
plant   102 IGGCDATSNLHKDGKL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 34/79 (43%)
GRXC2NP_001119339.1 GRX_GRXh_1_2_like 42..120 CDD:239511 34/76 (45%)

Return to query results.
Submit another query.