DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and AT5G20500

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_197550.1 Gene:AT5G20500 / 832172 AraportID:AT5G20500 Length:135 Species:Arabidopsis thaliana


Alignment Length:116 Identity:57/116 - (49%)
Similarity:74/116 - (63%) Gaps:5/116 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TVVSTLQRPTLYVSMDSS-----HAQFVRDTISGNKVVIFSKSYCPYCSMAKEQFRKINVKATVI 62
            ::|..|.....::||.||     .|.||:.|||.:|:|||||||||||..||..||:::....|:
plant     8 SMVMLLVALVTFISMVSSAASSPEADFVKKTISSHKIVIFSKSYCPYCKKAKSVFRELDQVPYVV 72

  Fly    63 ELDQRDDGNEIQAVLGEMTGSRTVPRCFIDGKFVGGGTDVKRLYEQGILQK 113
            |||:|:||..||..|||:.|.||||:.||:||.:||..|....||.|.|.|
plant    73 ELDEREDGWSIQTALGEIVGRRTVPQVFINGKHLGGSDDTVDAYESGELAK 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 44/79 (56%)
AT5G20500NP_197550.1 GRX_GRXh_1_2_like 43..124 CDD:239511 45/81 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 80 1.000 Domainoid score I2990
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2092
OMA 1 1.010 - - QHG53522
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 1 1.000 - - FOG0000858
OrthoInspector 1 1.000 - - mtm1143
orthoMCL 1 0.900 - - OOG6_100315
Panther 1 1.100 - - O PTHR45694
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X228
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.