DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and ROXY2

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_196911.1 Gene:ROXY2 / 831256 AraportID:AT5G14070 Length:140 Species:Arabidopsis thaliana


Alignment Length:98 Identity:35/98 - (35%)
Similarity:39/98 - (39%) Gaps:18/98 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NKVVIFSKSYCPYCSMAKEQFRKINVKATVIELDQRDDGNEIQAVL--------GEMTGSRTVPR 88
            |.|||||.|.|..|...|..||.:.|...|.|||....|.||...|        |..|....:|.
plant    41 NAVVIFSVSTCCMCHAIKRLFRGMGVSPAVHELDLLPYGVEIHRALLRLLGCSSGGATSPGALPV 105

  Fly    89 CFIDGKFVG----------GGTDVKRLYEQGIL 111
            .||.||.||          .|:.|..|.:.|.|
plant   106 VFIGGKMVGAMERVMASHINGSLVPLLKDAGAL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 34/97 (35%)
ROXY2NP_196911.1 GlrX-like_plant 37..140 CDD:274023 35/98 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.