DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and AT4G15660

DIOPT Version :10

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_193301.1 Gene:AT4G15660 / 827243 AraportID:AT4G15660 Length:102 Species:Arabidopsis thaliana


Alignment Length:82 Identity:31/82 - (37%)
Similarity:43/82 - (52%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VRDTISGNKVVIFSKSYCPYCSMAKEQFRKINVKATVIELDQRDDGNEIQAVLGEMTGSRTVPRC 89
            ::..||...|||||.:.|......|..|..:.|..|:.|||:.:.|.||:..|.::..|.|||..
plant     4 IQKMISEKSVVIFSNNSCCMSHTIKTLFLDLGVNPTIYELDEINRGKEIEYALAQLGCSPTVPVV 68

  Fly    90 FIDGKFVGGGTDVKRLY 106
            ||.|:.|||...|..|:
plant    69 FIGGQLVGGANQVMSLH 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 29/74 (39%)
AT4G15660NP_193301.1 GlrX-like_plant 4..102 CDD:274023 31/82 (38%)

Return to query results.
Submit another query.