DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and AT3G62960

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_191855.1 Gene:AT3G62960 / 825471 AraportID:AT3G62960 Length:102 Species:Arabidopsis thaliana


Alignment Length:78 Identity:30/78 - (38%)
Similarity:41/78 - (52%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VVIFSKSYCPYCSMAKEQFRKINVKATVIELDQRDDGNEIQAVLGEMTGSRTVPRCFIDGKFVGG 98
            ||||:||.|..|...:..||.:.|:.|:.|:|...|..||:..|..:..:..||..|:.||.||.
plant    13 VVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDNDPDCREIEKALVRLGCANAVPAVFVSGKLVGS 77

  Fly    99 GTDVKRLYEQGIL 111
            ..||..|:..|.|
plant    78 TNDVMSLHLSGSL 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 30/78 (38%)
AT3G62960NP_191855.1 GlrX-like_plant 4..98 CDD:274023 30/78 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.