DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and AT3G62950

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_191854.1 Gene:AT3G62950 / 825470 AraportID:AT3G62950 Length:103 Species:Arabidopsis thaliana


Alignment Length:90 Identity:27/90 - (30%)
Similarity:45/90 - (50%) Gaps:1/90 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VRDTISGNKVVIFSKSYCPYCSMAKEQFRKINVKATVIELDQRDDGNEIQAVLGEMTGSR-TVPR 88
            :||..|....|||:||.|..|...|..|.::.....:.|||:..:|.|::..|..:..|. .||.
plant     4 IRDLSSKKAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDKDPEGREMERALRALGSSNPAVPA 68

  Fly    89 CFIDGKFVGGGTDVKRLYEQGILQK 113
            .|:.|:::|...|:...:..|.|::
plant    69 VFVGGRYIGSAKDIISFHVDGSLKQ 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 24/80 (30%)
AT3G62950NP_191854.1 GlrX-like_plant 4..103 CDD:274023 27/90 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.