DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and AT3G62930

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_191852.1 Gene:AT3G62930 / 825468 AraportID:AT3G62930 Length:102 Species:Arabidopsis thaliana


Alignment Length:81 Identity:31/81 - (38%)
Similarity:39/81 - (48%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VRDTISGNKVVIFSKSYCPYCSMAKEQFRKINVKATVIELDQRDDGNEIQAVLGEMTGSRTVPRC 89
            ||..:....|||||||.|......:........|.||.||||..:|.||:..|.:|....:||..
plant     4 VRSLVEDKPVVIFSKSSCCMSHSIQTLISGFGAKMTVYELDQFSNGQEIEKALVQMGCKPSVPAV 68

  Fly    90 FIDGKFVGGGTDVKRL 105
            ||..:|:||...|..|
plant    69 FIGQQFIGGANQVMTL 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 29/73 (40%)
AT3G62930NP_191852.1 GlrX-like_plant 4..101 CDD:274023 31/81 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.