DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and Glrx2

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001033681.1 Gene:Glrx2 / 69367 MGIID:1916617 Length:156 Species:Mus musculus


Alignment Length:87 Identity:45/87 - (51%)
Similarity:62/87 - (71%) Gaps:0/87 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VRDTISGNKVVIFSKSYCPYCSMAKEQFRKINVKATVIELDQRDDGNEIQAVLGEMTGSRTVPRC 89
            :::|||.|.||||||:.|.||||||:.|..:||....:|||..:.||:.|..|.:|||.|||||.
Mouse    53 IQETISNNCVVIFSKTSCSYCSMAKKIFHDMNVNYKAVELDMLEYGNQFQDALHKMTGERTVPRI 117

  Fly    90 FIDGKFVGGGTDVKRLYEQGIL 111
            |::|:|:||..|..||:::|.|
Mouse   118 FVNGRFIGGAADTHRLHKEGKL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 41/79 (52%)
Glrx2NP_001033681.1 GRX_GRXh_1_2_like 61..142 CDD:239511 41/79 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I9037
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41098
Inparanoid 1 1.050 98 1.000 Inparanoid score I5001
Isobase 1 0.950 - 0 Normalized mean entropy S1664
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000858
OrthoInspector 1 1.000 - - otm43894
orthoMCL 1 0.900 - - OOG6_100315
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R496
SonicParanoid 1 1.000 - - X228
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.740

Return to query results.
Submit another query.