DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and glrx

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001005942.1 Gene:glrx / 449769 ZFINID:ZDB-GENE-041010-11 Length:105 Species:Danio rerio


Alignment Length:98 Identity:41/98 - (41%)
Similarity:55/98 - (56%) Gaps:3/98 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AQFVRDTISGNKVVIFSKSYCPYCSMAKEQFRKINVKA---TVIELDQRDDGNEIQAVLGEMTGS 83
            |:||:..|...|.|:|.|..|.||.:||:...|...||   .:|::..|.|...||..|.::||:
Zfish     2 AEFVKAQIKDGKGVVFCKPTCSYCILAKDVLSKYKFKAGHFELIDISARADMGSIQDYLQQITGA 66

  Fly    84 RTVPRCFIDGKFVGGGTDVKRLYEQGILQKYFQ 116
            |||||.||....||||:||:.|...|.|:...|
Zfish    67 RTVPRVFIGEDCVGGGSDVEGLDRSGKLEGMLQ 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 36/82 (44%)
glrxNP_001005942.1 GRX_GRXh_1_2_like 13..97 CDD:239511 36/83 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100315
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R496
SonicParanoid 1 1.000 - - X228
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.