DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and glrx2

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:XP_005161790.1 Gene:glrx2 / 436677 ZFINID:ZDB-GENE-040718-101 Length:170 Species:Danio rerio


Alignment Length:113 Identity:53/113 - (46%)
Similarity:72/113 - (63%) Gaps:11/113 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RPTLYVSM-----------DSSHAQFVRDTISGNKVVIFSKSYCPYCSMAKEQFRKINVKATVIE 63
            ||.:...|           .|:..|||:|.:|.|.||||||:.||||.|||..|.:|.....|:|
Zfish    30 RPVIITRMGNFSSSAPGLSSSACGQFVQDIVSSNCVVIFSKTTCPYCKMAKGVFNEIGATYKVVE 94

  Fly    64 LDQRDDGNEIQAVLGEMTGSRTVPRCFIDGKFVGGGTDVKRLYEQGIL 111
            ||:.:||..:|..|.|:||:|||||.||:|:.:|||:|.|:|::||.|
Zfish    95 LDEHNDGRRLQETLAELTGARTVPRVFINGQCIGGGSDTKQLHQQGKL 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 43/79 (54%)
glrx2XP_005161790.1 GRX_GRXh_1_2_like 64..145 CDD:239511 43/79 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587928
Domainoid 1 1.000 77 1.000 Domainoid score I8783
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41098
Inparanoid 1 1.050 108 1.000 Inparanoid score I4889
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 1 1.000 - - FOG0000858
OrthoInspector 1 1.000 - - otm25883
orthoMCL 1 0.900 - - OOG6_100315
Panther 1 1.100 - - O PTHR45694
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R496
SonicParanoid 1 1.000 - - X228
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.