DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and Grx1

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001246827.1 Gene:Grx1 / 40053 FlyBaseID:FBgn0036820 Length:114 Species:Drosophila melanogaster


Alignment Length:116 Identity:79/116 - (68%)
Similarity:95/116 - (81%) Gaps:2/116 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGTVVSTLQRPTLYVSMDSSHAQFVRDTISGNKVVIFSKSYCPYCSMAKEQFRKINVKATVIELD 65
            ||.|.|.|:.|  .|.|.:..|:||.:||:.||||||||:|||||:||||.|:|:||.||:||||
  Fly     1 MGAVGSALRSP--IVDMSTKQAKFVENTIASNKVVIFSKTYCPYCTMAKEPFKKLNVDATIIELD 63

  Fly    66 QRDDGNEIQAVLGEMTGSRTVPRCFIDGKFVGGGTDVKRLYEQGILQKYFQ 116
            ...|||||||||||:||:|||||.||||||:|||||:||::|.|.||||||
  Fly    64 GNPDGNEIQAVLGEITGARTVPRVFIDGKFIGGGTDIKRMFETGALQKYFQ 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 60/79 (76%)
Grx1NP_001246827.1 GRX_GRXh_1_2_like 31..111 CDD:239511 60/79 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469746
Domainoid 1 1.000 80 1.000 Domainoid score I2990
eggNOG 1 0.900 - - E1_COG0695
Homologene 1 1.000 - - H41098
Inparanoid 1 1.050 108 1.000 Inparanoid score I2092
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53522
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 1 1.000 - - FOG0000858
OrthoInspector 1 1.000 - - otm25883
orthoMCL 1 0.900 - - OOG6_100315
Panther 1 1.100 - - P PTHR45694
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R496
SonicParanoid 1 1.000 - - X228
1413.840

Return to query results.
Submit another query.