DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and txnrd3

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_898895.2 Gene:txnrd3 / 352924 ZFINID:ZDB-GENE-030327-3 Length:602 Species:Danio rerio


Alignment Length:102 Identity:41/102 - (40%)
Similarity:64/102 - (62%) Gaps:3/102 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VSMDSSHAQF---VRDTISGNKVVIFSKSYCPYCSMAKEQFRKINVKATVIELDQRDDGNEIQAV 76
            :..|:...|.   :::.|..:.||:||||:||:|...|:.|:::|||...||||..:||...|.:
Zfish     4 IENDAGREQIRSKIKELIDSSAVVVFSKSFCPFCVKVKDLFKELNVKYNTIELDLMEDGTNYQDL 68

  Fly    77 LGEMTGSRTVPRCFIDGKFVGGGTDVKRLYEQGILQK 113
            |.||||.:|||..||:.|.:||..:..:.::.|:|||
Zfish    69 LHEMTGQKTVPNVFINKKHIGGCDNTMKAHKDGVLQK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 36/79 (46%)
txnrd3NP_898895.2 GRX_GRXh_1_2_like 25..106 CDD:239511 38/81 (47%)
TGR 114..602 CDD:273624
NADB_Rossmann 114..>160 CDD:304358
Pyr_redox 295..371 CDD:278498
Pyr_redox_dim 474..584 CDD:280934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.