powered by:
Protein Alignment Grx1t and Sh3bgrl3
DIOPT Version :9
Sequence 1: | NP_611609.1 |
Gene: | Grx1t / 37483 |
FlyBaseID: | FBgn0034658 |
Length: | 116 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001100158.1 |
Gene: | Sh3bgrl3 / 298544 |
RGDID: | 1308118 |
Length: | 93 |
Species: | Rattus norvegicus |
Alignment Length: | 37 |
Identity: | 10/37 - (27%) |
Similarity: | 16/37 - (43%) |
Gaps: | 8/37 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 YVSMDSSHAQFVRD---TISGN-----KVVIFSKSYC 42
|..:|.|....:|| |::|| ..::....||
Rat 35 YQLVDISQDNALRDEMRTLAGNPKATPPQIVNGDHYC 71
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.