DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and grx1

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_594763.1 Gene:grx1 / 2543556 PomBaseID:SPAC4F10.20 Length:101 Species:Schizosaccharomyces pombe


Alignment Length:97 Identity:41/97 - (42%)
Similarity:60/97 - (61%) Gaps:0/97 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SSHAQFVRDTISGNKVVIFSKSYCPYCSMAKEQFRKINVKATVIELDQRDDGNEIQAVLGEMTGS 83
            ||...||...::.|.||:|:|||||||...::......:||.|.::|..::|:|||:.|.:.||.
pombe     2 SSVESFVDSAVADNDVVVFAKSYCPYCHATEKVIADKKIKAQVYQIDLMNNGDEIQSYLLKKTGQ 66

  Fly    84 RTVPRCFIDGKFVGGGTDVKRLYEQGILQKYF 115
            ||||..||..|.|||.:|.:.|:::|.|...|
pombe    67 RTVPNIFIHQKHVGGNSDFQALFKKGELDSLF 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 35/79 (44%)
grx1NP_594763.1 GRX_GRXh_1_2_like 17..97 CDD:239511 35/79 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I2941
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I1798
OMA 1 1.010 - - QHG53522
OrthoFinder 1 1.000 - - FOG0000858
OrthoInspector 1 1.000 - - mtm9315
orthoMCL 1 0.900 - - OOG6_100315
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R496
SonicParanoid 1 1.000 - - X228
TreeFam 1 0.960 - -
1211.760

Return to query results.
Submit another query.