DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and grx2

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_594310.1 Gene:grx2 / 2542807 PomBaseID:SPAC15E1.09 Length:110 Species:Schizosaccharomyces pombe


Alignment Length:97 Identity:40/97 - (41%)
Similarity:54/97 - (55%) Gaps:0/97 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MDSSHAQFVRDTISGNKVVIFSKSYCPYCSMAKEQFRKINVKATVIELDQRDDGNEIQAVLGEMT 81
            |.|....||...||.|.|.:||||:||:|..||....|.:......|||:.::|::|||.|.|.|
pombe     1 MTSIAKAFVEKAISNNPVTVFSKSFCPFCKAAKNTLTKYSAPYKAYELDKIENGSDIQAYLHEKT 65

  Fly    82 GSRTVPRCFIDGKFVGGGTDVKRLYEQGILQK 113
            ...|||..|...:|:||.:|:.:|...|.|.|
pombe    66 KQSTVPSIFFRNQFIGGNSDLNKLRSSGTLTK 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 32/79 (41%)
grx2NP_594310.1 GRX_GRXh_1_2_like 17..98 CDD:239511 33/81 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53522
OrthoFinder 1 1.000 - - FOG0000858
OrthoInspector 1 1.000 - - mtm9315
orthoMCL 1 0.900 - - OOG6_100315
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R496
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.710

Return to query results.
Submit another query.