DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and grx3

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_588305.1 Gene:grx3 / 2539000 PomBaseID:SPCC1450.06c Length:166 Species:Schizosaccharomyces pombe


Alignment Length:84 Identity:26/84 - (30%)
Similarity:47/84 - (55%) Gaps:3/84 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NKVVIFSKSYCPYCSMAKE---QFRKINVKATVIELDQRDDGNEIQAVLGEMTGSRTVPRCFIDG 93
            |.|:|||:..|||.:.||:   :..:::..|.|:|:...:...|::..|..::...|:|..|:.|
pombe    66 NPVIIFSRPGCPYSAAAKKLLTETLRLDPPAVVVEVTDYEHTQELRDWLSSISDISTMPNIFVGG 130

  Fly    94 KFVGGGTDVKRLYEQGILQ 112
            ..:||...|:.||::..||
pombe   131 HSIGGSDSVRALYQEEKLQ 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 25/83 (30%)
grx3NP_588305.1 GRX_euk 68..152 CDD:274016 25/82 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100315
Panther 1 1.100 - - O PTHR45694
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R496
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.