DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and Txnrd3

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001171529.1 Gene:Txnrd3 / 232223 MGIID:2386711 Length:652 Species:Mus musculus


Alignment Length:92 Identity:41/92 - (44%)
Similarity:59/92 - (64%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VRDTISGNKVVIFSKSYCPYCSMAKEQFRKINVKATVIELDQRDDGNEIQAVLGEMTGSRTVPRC 89
            :||.|.||:|:||||||||:.:..||.|..:.|...::||||.|||..:|.||.|::..:|||..
Mouse    68 LRDLIEGNRVMIFSKSYCPHSTRVKELFSSLGVVYNILELDQVDDGASVQEVLTEISNQKTVPNI 132

  Fly    90 FIDGKFVGGGTDVKRLYEQGILQKYFQ 116
            |::...|||.....:.::.|:|||..|
Mouse   133 FVNKVHVGGCDRTFQAHQNGLLQKLLQ 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 33/79 (42%)
Txnrd3NP_001171529.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
GRX_GRXh_1_2_like 76..157 CDD:239511 34/80 (43%)
TGR 164..652 CDD:273624
Pyr_redox 347..421 CDD:278498
Pyr_redox_dim 524..634 CDD:280934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R496
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.