DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and pqn-26

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_492375.3 Gene:pqn-26 / 183974 WormBaseID:WBGene00004115 Length:664 Species:Caenorhabditis elegans


Alignment Length:46 Identity:13/46 - (28%)
Similarity:24/46 - (52%) Gaps:0/46 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LDQRDDGNEIQAVLGEMTGSRTVPRCFIDGKFVGGGTDVKRLYEQG 109
            :|:.|....||..|.::|..:.:|..||.|.|:|..:.::..:..|
 Worm   593 VDKTDKPAAIQRQLQQLTAHKGLPYLFICGTFIGSESHIENYHTNG 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 13/46 (28%)
pqn-26NP_492375.3 Thioredoxin_like 574..643 CDD:381987 13/46 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 1 1.000 - - FOG0000858
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.