powered by:
Protein Alignment Grx1t and pqn-26
DIOPT Version :9
Sequence 1: | NP_611609.1 |
Gene: | Grx1t / 37483 |
FlyBaseID: | FBgn0034658 |
Length: | 116 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_492375.3 |
Gene: | pqn-26 / 183974 |
WormBaseID: | WBGene00004115 |
Length: | 664 |
Species: | Caenorhabditis elegans |
Alignment Length: | 46 |
Identity: | 13/46 - (28%) |
Similarity: | 24/46 - (52%) |
Gaps: | 0/46 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 LDQRDDGNEIQAVLGEMTGSRTVPRCFIDGKFVGGGTDVKRLYEQG 109
:|:.|....||..|.::|..:.:|..||.|.|:|..:.::..:..|
Worm 593 VDKTDKPAAIQRQLQQLTAHKGLPYLFICGTFIGSESHIENYHTNG 638
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0695 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1535999at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000858 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.820 |
|
Return to query results.
Submit another query.