DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and F10D7.3

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_510815.2 Gene:F10D7.3 / 181766 WormBaseID:WBGene00017340 Length:146 Species:Caenorhabditis elegans


Alignment Length:113 Identity:35/113 - (30%)
Similarity:63/113 - (55%) Gaps:2/113 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGTVVSTLQRPTLYVSMDSSHAQFVRDTISGNKVVIFSKSYCPYCSMAKEQFRKINV-KATVIEL 64
            :.||.:.|.:.....::.....:.|.|.:: :||:::||:|||:....|.......: ...::||
 Worm    14 IATVHAELSKKKEDKTLKDLEDKIVNDVMT-HKVMVYSKTYCPWSKRLKAILANYEIDDMKIVEL 77

  Fly    65 DQRDDGNEIQAVLGEMTGSRTVPRCFIDGKFVGGGTDVKRLYEQGILQ 112
            |:.:...|:|.:|.:.:|..|||:.||.||||||..:.|.:.|:|.|:
 Worm    78 DRSNQTEEMQEILKKYSGRTTVPQLFISGKFVGGHDETKAIEEKGELR 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 30/81 (37%)
F10D7.3NP_510815.2 GRX_euk 46..128 CDD:274016 29/80 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167040
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53522
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 1 1.000 - - FOG0000858
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100315
Panther 1 1.100 - - O PTHR45694
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.