DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and AgaP_AGAP002500

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:XP_312440.3 Gene:AgaP_AGAP002500 / 1273462 VectorBaseID:AGAP002500 Length:145 Species:Anopheles gambiae


Alignment Length:91 Identity:22/91 - (24%)
Similarity:46/91 - (50%) Gaps:6/91 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VRDTISGNKVVIFSKSY--CPYCSMAKEQFRKINVKATVIELDQRD--DGNEIQAVLGEMTGSRT 85
            :...:|.||||:|.|..  .|.|..:....:.:.:.:  ::.|..|  ....::..:.:.:...|
Mosquito    38 IEKLVSNNKVVVFMKGNPDAPRCGFSNAVVQILRMHS--VKYDSHDVLQNEALRQGIKDFSNWPT 100

  Fly    86 VPRCFIDGKFVGGGTDVKRLYEQGIL 111
            :|:.||:|:||||...:.::::.|.|
Mosquito   101 IPQVFINGEFVGGCDILLQMHQNGEL 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 20/83 (24%)
AgaP_AGAP002500XP_312440.3 GRX_PICOT_like 38..126 CDD:239326 21/89 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.