DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and AgaP_AGAP003415

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:XP_311699.2 Gene:AgaP_AGAP003415 / 1272788 VectorBaseID:AGAP003415 Length:220 Species:Anopheles gambiae


Alignment Length:135 Identity:32/135 - (23%)
Similarity:56/135 - (41%) Gaps:25/135 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GTVVSTL---------QRPTLYVSMD----------SSHAQFVRDTISGNKVVIFSKS--YCPYC 45
            ||.|..:         |:...|..|.          |:..:.::..|:.:||:||.|.  ..|.|
Mosquito    84 GTAVDRIDGVDVGMLTQKAKKYAGMPTTPSPAGDGASNLEERLKALINRSKVMIFMKGDRNTPRC 148

  Fly    46 SMAKEQFRKINVKATVIELDQRD--DGNEIQAVLGEMTGSRTVPRCFIDGKFVGGGTDVKRLYEQ 108
            ..:|:....:|  .|.:|.|..|  ....::..|...:...|.|:.::.|:.:||...:|.|.|.
Mosquito   149 GFSKQLIAIVN--DTGVEYDTFDILTDEAVRQGLKTFSNWPTYPQVYVSGELIGGLDIIKELLEG 211

  Fly   109 GILQK 113
            |.|::
Mosquito   212 GELKE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 24/83 (29%)
AgaP_AGAP003415XP_311699.2 PTZ00062 1..220 CDD:240250 32/135 (24%)
TRX_PICOT 8..103 CDD:239282 4/18 (22%)
GRX_PICOT_like 126..215 CDD:239326 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.