DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and IXR1

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_012893.3 Gene:IXR1 / 853836 SGDID:S000001515 Length:597 Species:Saccharomyces cerevisiae


Alignment Length:144 Identity:38/144 - (26%)
Similarity:56/144 - (38%) Gaps:42/144 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKD----------KSEWEAKAAKA 59
            ||||.|||.|:..|.|..:.::.|..||.|::|.....|:.:.|          ::.|| |....
Yeast   361 PKRPSSAYFLFSMSIRNELLQQFPEAKVPELSKLASARWKELTDDQKKPFYEEFRTNWE-KYRVV 424

  Fly    60 KDDYDR---------------------AVKEFEANGGSSAANGGGAK-KRAKPAKKV------AK 96
            :|.|::                     .|||....|........|.: :...||||.      .|
Yeast   425 RDAYEKTLPPKRPSGPFIQFTQEIRPTVVKENPDKGLIEITKIIGERWRELDPAKKAEYTETYKK 489

  Fly    97 KSKKEES---DEDD 107
            :.|:.||   ||:|
Yeast   490 RLKEWESCYPDEND 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 22/93 (24%)
IXR1NP_012893.3 NHP6B <338..501 CDD:227935 35/140 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100324
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.