DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and Tfam

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_112616.2 Gene:Tfam / 83474 RGDID:620682 Length:244 Species:Rattus norvegicus


Alignment Length:140 Identity:31/140 - (22%)
Similarity:58/140 - (41%) Gaps:37/140 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKD----------KSEWEAK 55
            :.:.||:|:|:|:.:........|.::|..||:|:.::...:||.:.:          |:||:. 
  Rat    45 LGNYPKKPMSSYLRFSTEQLPKFKAKHPDAKVSELIRKIAAMWRELPEAEKKVYEADFKAEWKV- 108

  Fly    56 AAKAKDDYDRAVKEFEANGGSSAANGGGAKKRAKPAKKVAKKSKKE------------------- 101
                   |..||.:::.....|...|...:.|.|..||.|:..::|                   
  Rat   109 -------YKEAVSKYKEQLTPSQLMGLEKEARQKRLKKKAQIKRRELILLGKPKRPRSAYNIYVS 166

  Fly   102 ESDEDDDDES 111
            ||.::..|||
  Rat   167 ESFQEAKDES 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 17/72 (24%)
TfamNP_112616.2 NHP6B <46..215 CDD:227935 31/139 (22%)
HMG_box 49..116 CDD:395407 18/74 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..244
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.