DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and 3xHMG-box1

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_192846.1 Gene:3xHMG-box1 / 826709 AraportID:AT4G11080 Length:446 Species:Arabidopsis thaliana


Alignment Length:101 Identity:33/101 - (32%)
Similarity:55/101 - (54%) Gaps:19/101 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKD--KSEWEAKAAKAKDDYDRA 66
            |||:|:|||:::.|..|.::|.||.  .|.||||..||.|:.:.:  |:.::..|.|.|:.|   
plant   245 KPKQPISAYLIYANERRAALKGENK--SVIEVAKMAGEEWKNLSEEKKAPYDQMAKKNKEIY--- 304

  Fly    67 VKEFEANGGSSAANGGGAKKRAKPAKKVAKKSKKEE 102
            ::|.|            ..||.|..:.:::|.::||
plant   305 LQEME------------GYKRTKEEEAMSQKKEEEE 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 24/64 (38%)
3xHMG-box1NP_192846.1 HMGB-UBF_HMG-box 130..193 CDD:238686
HMGB-UBF_HMG-box 246..309 CDD:238686 25/67 (37%)
HMGB-UBF_HMG-box 372..437 CDD:238686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm3355
orthoMCL 1 0.900 - - OOG6_100324
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.