DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and HMGB1

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_974413.1 Gene:HMGB1 / 824351 AraportID:AT3G51880 Length:185 Species:Arabidopsis thaliana


Alignment Length:138 Identity:44/138 - (31%)
Similarity:70/138 - (50%) Gaps:32/138 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKPKRPLSAYMLWLNSARESIKRENPGIK-VTEVAKRGGELWRAMK--DKSEWEAKAAKAKDDYD 64
            :||||..||:.::|...|.:.|:|||.:| |:.|.|.||:.|::|.  :|:.:|.||||.|.:|:
plant    51 NKPKRAPSAFFVFLEDFRVTFKKENPNVKAVSAVGKAGGQKWKSMSQAEKAPYEEKAAKRKAEYE 115

  Fly    65 RAVKEFEAN--GGSSAANGGGAKKRA-----------------------KPAKKVAKKSKKEESD 104
            :.:..:..|  .||..:.    |.|:                       |.|....::.::||.|
plant   116 KQMDAYNKNLEEGSDESE----KSRSEINDEDEASGEVTIPLSNEELLEKEAAGDDEEEEEEEDD 176

  Fly   105 EDDDDESE 112
            :|||||.|
plant   177 DDDDDEEE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 27/65 (42%)
HMGB1NP_974413.1 HMG_box 53..121 CDD:278906 27/67 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3986
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I2470
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm3355
orthoMCL 1 0.900 - - OOG6_100324
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.