DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and HMGB4

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001031364.2 Gene:HMGB4 / 816263 AraportID:AT2G17560 Length:138 Species:Arabidopsis thaliana


Alignment Length:111 Identity:35/111 - (31%)
Similarity:57/111 - (51%) Gaps:10/111 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKPKRPLSAYMLWLNSARESIKRENPGIK-VTEVAKRGGELWRAM--KDKSEWEAKAAKAKDDYD 64
            ::||||.||:.::|...|:.....||..| |..|.|..|..|:||  :||:.:.|||...|.:|.
plant    33 NQPKRPPSAFFVFLEDFRKEFNLANPNNKSVATVGKAAGARWKAMTDEDKAPYVAKAESRKTEYI 97

  Fly    65 RAVKEFEAN--GGSSAANGGGAKKRAKPAKKVAKKSKKEESDEDDD 108
            :.|:::...  .|::.......|.:::..:.|:     ||..||||
plant    98 KNVQQYNLKLASGTNREEDDSDKSKSEVDEAVS-----EEEAEDDD 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 25/65 (38%)
HMGB4NP_001031364.2 HMG_box 35..103 CDD:278906 26/67 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3986
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I2470
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100324
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.