DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and TFAM

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_003192.1 Gene:TFAM / 7019 HGNCID:11741 Length:246 Species:Homo sapiens


Alignment Length:107 Identity:26/107 - (24%)
Similarity:43/107 - (40%) Gaps:18/107 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKD----------KSEWEAKAAKA 59
            ||:|:|:|:.:........|.:||..|.||:.:|..:.||.:.|          ::||:.     
Human    50 PKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQV----- 109

  Fly    60 KDDYDRAVKEFEANGGSSAANGGGAKKRAKPAKKVAKKSKKE 101
               |...:..|:.....|.......:...|..|:.|...|||
Human   110 ---YKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKE 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 18/72 (25%)
TFAMNP_003192.1 HMG_box 50..117 CDD:395407 18/74 (24%)
HMGB-UBF_HMG-box 155..216 CDD:238686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.