DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and Hmgb4

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001102933.1 Gene:Hmgb4 / 685271 RGDID:1596426 Length:181 Species:Rattus norvegicus


Alignment Length:84 Identity:25/84 - (29%)
Similarity:45/84 - (53%) Gaps:2/84 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMK--DKSEWEAKAAKAKDDYDRAV 67
            |::|.|:::|:.......:|:|||...|.:|||..|::|..:.  ||..:|.|||..:..|.:..
  Rat    93 PRKPPSSFLLFSLDHFAKLKQENPNWTVVQVAKAAGKMWSMITDVDKRPYEQKAAIMRAKYFQER 157

  Fly    68 KEFEANGGSSAANGGGAKK 86
            :.:.:...:|..|..|:.|
  Rat   158 EAYLSQCQNSKINLQGSSK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 21/64 (33%)
Hmgb4NP_001102933.1 HMGB-UBF_HMG-box 9..75 CDD:238686
HMG-box 93..158 CDD:238037 21/64 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.