DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and SRY

DIOPT Version :10

Sequence 1:NP_726109.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_003131.1 Gene:SRY / 6736 HGNCID:11311 Length:204 Species:Homo sapiens


Alignment Length:63 Identity:18/63 - (28%)
Similarity:38/63 - (60%) Gaps:4/63 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEW----EAKAAKA 59
            :.|:.|||::|:::|....|..:..|||.::.:|::|:.|..|:.:.:..:|    ||:..:|
Human    56 VQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQA 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_726109.1 HMG-box_SSRP1-like 7..71 CDD:438810 16/57 (28%)
SRYNP_003131.1 HMG-box_SoxA_SRY 56..140 CDD:438843 18/63 (29%)
Sufficient for interaction with KPNB1. /evidence=ECO:0000269|PubMed:15297880 59..136 17/60 (28%)
Required for nuclear localization. /evidence=ECO:0000269|PubMed:12764225, ECO:0000269|PubMed:15746192 61..77 6/15 (40%)
Sufficient for interaction with EP300. /evidence=ECO:0000269|PubMed:15297880 107..139 4/12 (33%)
Required for nuclear localization. /evidence=ECO:0000269|PubMed:15297880 130..136
Necessary for interaction with ZNF208 isoform KRAB-O. /evidence=ECO:0000269|PubMed:15469996 138..155
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..204
Necessary for interaction with SLC9A3R2. /evidence=ECO:0000269|PubMed:9054412 198..204
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.