DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and SP100

DIOPT Version :10

Sequence 1:NP_726109.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001073860.1 Gene:SP100 / 6672 HGNCID:11206 Length:885 Species:Homo sapiens


Alignment Length:100 Identity:21/100 - (21%)
Similarity:38/100 - (38%) Gaps:23/100 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKPKRPLS-----AYMLWLNSARES----IKR-----------ENPGIKVTEVAKRGGELWRAM- 46
            |:|::.|:     ....|....|::    :||           ||...|.:|:....||:...: 
Human   553 DRPRKHLTLNNKVQKKRWQQRGRKANTRPLKRRRKRGPRIPKDENINFKQSELPVTCGEVKGTLY 617

  Fly    47 --KDKSEWEAKAAKAKDDYDRAVKEFEANGGSSAA 79
              :.|.....|..:::|......:|||..|...|:
Human   618 KERFKQGTSKKCIQSEDKKWFTPREFEIEGDRGAS 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_726109.1 HMG-box_SSRP1-like 7..71 CDD:438810 15/86 (17%)
SP100NP_001073860.1 HSR 49..147 CDD:460835
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..245
D-box, recognition signal for CDC20-mediated degradation 165..168
PxVxL motif 284..297
Sufficient to mediate interaction with ETS1 333..478
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 345..386
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..596 7/42 (17%)
Nuclear localization signal. /evidence=ECO:0000255 536..553 21/99 (21%)
Nuclear localization signal. /evidence=ECO:0000255 568..592 4/23 (17%)
SAND 599..675 CDD:460167 12/53 (23%)
PHD_TIF1_like 704..745 CDD:277016
Bromo_SP100C_like 773..874 CDD:99933
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.