DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and SOX10

DIOPT Version :10

Sequence 1:NP_726109.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_008872.1 Gene:SOX10 / 6663 HGNCID:11190 Length:466 Species:Homo sapiens


Alignment Length:109 Identity:34/109 - (31%)
Similarity:54/109 - (49%) Gaps:14/109 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KP--KRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAM--KDKSEWEAKAAK-----A 59
            ||  |||::|:|:|..:||..:..:.|.:...|::|..|:|||.:  .||..:..:|.:     .
Human   101 KPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQHK 165

  Fly    60 KD--DY---DRAVKEFEANGGSSAANGGGAKKRAKPAKKVAKKS 98
            ||  ||   .|..|..:|..|.:...||.|::....|.:...||
Human   166 KDHPDYKYQPRRRKNGKAAQGEAECPGGEAEQGGTAAIQAHYKS 209

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_726109.1 HMG-box_SSRP1-like 7..71 CDD:438810 23/75 (31%)
SOX10NP_008872.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67
Sox_N 12..93 CDD:463586