DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and SOX3

DIOPT Version :10

Sequence 1:NP_726109.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_005625.2 Gene:SOX3 / 6658 HGNCID:11199 Length:446 Species:Homo sapiens


Alignment Length:104 Identity:27/104 - (25%)
Similarity:48/104 - (46%) Gaps:22/104 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEW----EAKAAKAKDDY 63
            |:.|||::|:|:|....|..:..|||.:..:|::||.|..|:.:.|..:.    |||..:|..  
Human   137 DRVKRPMNAFMVWSRGQRRKMALENPKMHNSEISKRLGADWKLLTDAEKRPFIDEAKRLRAVH-- 199

  Fly    64 DRAVKEFEANGGSSAANGGGAKKRAKPAKKVAKKSKKEE 102
               :||:             ...:.:|.:|.....||::
Human   200 ---MKEY-------------PDYKYRPRRKTKTLLKKDK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_726109.1 HMG-box_SSRP1-like 7..71 CDD:438810 21/67 (31%)
SOX3NP_005625.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..140 1/2 (50%)
HMG-box_SoxB 137..212 CDD:438790 24/92 (26%)
SOXp 208..302 CDD:463537 4/15 (27%)
9aaTAD. /evidence=ECO:0000269|PubMed:34342803 399..407
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.