DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and tfam

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001070857.1 Gene:tfam / 571106 ZFINID:ZDB-GENE-061013-552 Length:277 Species:Danio rerio


Alignment Length:99 Identity:29/99 - (29%)
Similarity:59/99 - (59%) Gaps:2/99 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAM--KDKSEWEAKAAKAKDDYDRAV 67
            |||||:|||.::...:.::.::||.||..:|.::..:.|:.:  :.|..::..:.:||:.|..|:
Zfish    47 PKRPLTAYMTFVKDMQPTVSKQNPSIKSVDVMRKIAQQWKMLTTEQKQPFQVASLEAKEQYKLAL 111

  Fly    68 KEFEANGGSSAANGGGAKKRAKPAKKVAKKSKKE 101
            ::|:|....:.:.....:||.:.||:.|.:.|||
Zfish   112 EKFKAQLTPAESAAFAEEKRQRVAKRKAIRKKKE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 19/64 (30%)
tfamNP_001070857.1 HMG_box 47..114 CDD:278906 19/66 (29%)
HMGB-UBF_HMG-box 152..213 CDD:238686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.