DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and hmgb3b

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001017769.1 Gene:hmgb3b / 550466 ZFINID:ZDB-GENE-050417-290 Length:198 Species:Danio rerio


Alignment Length:112 Identity:39/112 - (34%)
Similarity:60/112 - (53%) Gaps:12/112 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKD--KSEWEAKAAKAKDDY--DR 65
            |:||.|.:.|:....|..||.:||.:.:.:|||:.|.:|..:.|  |..:.:.|.|.||.|  |.
Zfish    94 PRRPPSGFFLFCAEQRPIIKAQNPSLGIGDVAKKLGGMWNNLSDSEKQPFLSNADKLKDKYQKDM 158

  Fly    66 AVKEFEANGGSSAANGGGAKKRAKPAKKVAKKSKKEESDEDDDDESE 112
            |....:.:||||:|       :::| |.......:||.|:|||||.:
Zfish   159 AFYRKKGSGGSSSA-------KSEP-KDDDDDDDEEEEDDDDDDEDD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 24/66 (36%)
hmgb3bNP_001017769.1 HMG_box_2 7..78 CDD:286146
HMG_box 94..161 CDD:278906 24/66 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100324
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.