DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and SOX18

DIOPT Version :10

Sequence 1:NP_726109.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_060889.1 Gene:SOX18 / 54345 HGNCID:11194 Length:384 Species:Homo sapiens


Alignment Length:97 Identity:24/97 - (24%)
Similarity:47/97 - (48%) Gaps:13/97 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEWEAKAAKAKDDYDRAVKEF 70
            :||::|:|:|....|:.:.::||.:....::|..|:.|:        |..||:.:.    .|:|.
Human    86 RRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWK--------ELNAAEKRP----FVEEA 138

  Fly    71 EANGGSSAANGGGAKKRAKPAKKVAKKSKKEE 102
            |........:....|.|.: .||.|:|:::.|
Human   139 ERLRVQHLRDHPNYKYRPR-RKKQARKARRLE 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_726109.1 HMG-box_SSRP1-like 7..71 CDD:438810 16/63 (25%)
SOX18NP_060889.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..88 0/1 (0%)
HMG-box_SoxF_SOX18 82..161 CDD:438851 20/87 (23%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P43680 87..100 5/12 (42%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P43680 111..123 2/11 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..218 7/25 (28%)
Important for transcriptional activation. /evidence=ECO:0000250|UniProtKB:P43680 166..231 1/4 (25%)
Sox17_18_mid 197..245 CDD:463454
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..312
9aaTAD. /evidence=ECO:0000269|PubMed:17603017 325..333
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.