DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and RGD1559962

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:XP_008756867.1 Gene:RGD1559962 / 498988 RGDID:1559962 Length:209 Species:Rattus norvegicus


Alignment Length:115 Identity:44/115 - (38%)
Similarity:70/115 - (60%) Gaps:13/115 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELW--RAMKDKSEWEAKAAKAKDDYDRAV 67
            ||||.||:.|:.:..|..||.|:||:.:.:.||:.||:|  ::.|||..:|.||||.|::|::.:
  Rat    95 PKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEEYEKDI 159

  Fly    68 KEFEANGGSSAANGG-----GAKKRAKPAKKVAKKSKKEESDEDDDDESE 112
            ..:.|.|.|.....|     |:||:.:|      :.::||.:|||:||.|
  Rat   160 AAYRAKGKSEVGKKGPGRPTGSKKKNEP------EDEEEEEEEDDEDEEE 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 28/64 (44%)
RGD1559962XP_008756867.1 HMG-box 7..78 CDD:294061
HMG_box 95..162 CDD:278906 28/66 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.