DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and sox11

DIOPT Version :10

Sequence 1:NP_726109.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001008053.1 Gene:sox11 / 493415 XenbaseID:XB-GENE-483418 Length:383 Species:Xenopus tropicalis


Alignment Length:168 Identity:36/168 - (21%)
Similarity:62/168 - (36%) Gaps:61/168 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKS------EWEAKAAKAKDDY- 63
            |||::|:|:|....|..|..::|.:...|::||.|:.|:.:.|..      |.|....|...|| 
 Frog    49 KRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLNDSEKIPFIREAERLRLKHMADYP 113

  Fly    64 --------------------------DRAVKEFEA-----------NGGSSAANGG--------- 82
                                      :::.|...|           :.|||:::|.         
 Frog   114 DYKYRPRKKPKVDPSASKPASLAQSPEKSPKSRSAGKKCPKLKPGSHSGSSSSSGSAKSLTIKSE 178

  Fly    83 --------GAKKRAKPAKKVAKKSKKEESDEDDDDESE 112
                    |:.|.|..|.|.....:.:|.:|:|::|.|
 Frog   179 YGGDDYVFGSPKAASKAAKCVFMDEDDEEEEEDEEEDE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_726109.1 HMG-box_SSRP1-like 7..71 CDD:438810 20/96 (21%)
sox11NP_001008053.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
HMG-box_SoxC_SOX11 37..128 CDD:438846 20/78 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..174 6/58 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..231 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.