DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and SoxN

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster


Alignment Length:107 Identity:33/107 - (30%)
Similarity:46/107 - (42%) Gaps:27/107 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEW-------EAKAAKA 59
            :|:.|||::|:|:|....|..:..:||.:..:|::||.|..|   ||.||.       |||..:|
  Fly   176 ADRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQW---KDLSESEKRPFIDEAKRLRA 237

  Fly    60 -----KDDYD----------RAVKEFEANGGSSAAN--GGGA 84
                 ..||.          ...||....||.....  ||||
  Fly   238 VHMKEHPDYKYRPRRKTKTLTKTKEKYPMGGLMPGQTVGGGA 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 24/84 (29%)
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 24/73 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.