DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and TFAM

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster


Alignment Length:112 Identity:28/112 - (25%)
Similarity:51/112 - (45%) Gaps:12/112 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELW----RAMKDKSEWEAKA-----AKA 59
            :||:||:.|..::...|..:|..||.|...||.::..:.|    ..:|::.:.|.|.     .:.
  Fly    77 RPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYVEE 141

  Fly    60 KDDYDRAV-KEFEANGGSSAANGGGAKKRAKPAKKVAK--KSKKEES 103
            :..||..: :|..|.......:...||:|.:..|:|.:  :.||..|
  Fly   142 RTKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKRVKELGRPKKPAS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 18/72 (25%)
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 16/63 (25%)
HMGB-UBF_HMG-box 183..247 CDD:238686 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48112
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.