DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and hmg20b

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:XP_017947143.1 Gene:hmg20b / 394538 XenbaseID:XB-GENE-5809048 Length:327 Species:Xenopus tropicalis


Alignment Length:102 Identity:27/102 - (26%)
Similarity:50/102 - (49%) Gaps:14/102 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAM--KDKSEWEAKAAKAKDDYDRAV 67
            ||.|::.|:.:||..||.|:.::|.:...|:.|..|..|..:  .:|..:..:|.:.|..|.:.:
 Frog    68 PKAPVTGYVRFLNERREQIRAQHPDLPFPEITKMLGAEWSTLPPHEKQRYLDEAERDKQQYMKEL 132

  Fly    68 KEFEANGGSSAANGGGAKKRAKPAKKV-AKKSKKEES 103
            :|::.:......           |:|: .||.||||:
 Frog   133 REYQQSEAYKMC-----------AEKIQEKKIKKEET 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 18/64 (28%)
hmg20bXP_017947143.1 HMGB-UBF_HMG-box 68..133 CDD:238686 18/64 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.