DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and hmgb2

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_988904.1 Gene:hmgb2 / 394499 XenbaseID:XB-GENE-1000246 Length:212 Species:Xenopus tropicalis


Alignment Length:115 Identity:45/115 - (39%)
Similarity:69/115 - (60%) Gaps:7/115 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELW--RAMKDKSEWEAKAAKAKDDYDRAV 67
            ||||.||:.|:.:..|..||.|:||:.:.:.||:.||:|  :..|||..:|.||||.|:.|::.|
 Frog    96 PKRPPSAFFLFCSEHRPQIKSESPGLSIGDTAKKLGEMWSEQTPKDKLPYEQKAAKLKEKYEKDV 160

  Fly    68 KEFEANGGSSA-----ANGGGAKKRAKPAKKVAKKSKKEESDEDDDDESE 112
            ..::|.|.|..     ....|:||:|:|.:....:.:.||.:||||||.:
 Frog   161 AAYKAKGKSDVGKKVPGRPTGSKKKAEPEEDDDDEDEDEEDEEDDDDEDD 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 28/64 (44%)
hmgb2NP_988904.1 HMG_box_2 6..78 CDD:370242
HMG_box 96..163 CDD:366139 29/66 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.