DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and HmgZ

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster


Alignment Length:111 Identity:72/111 - (64%)
Similarity:92/111 - (82%) Gaps:4/111 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEWEAKAAKAKDDYDRAV 67
            |:|||||||||||||..||.||::|||.|||::|||||||||.:|||:|||.||.|.|::|::||
  Fly     4 DRPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKDKTEWEQKAIKMKEEYNKAV 68

  Fly    68 KEFEANGGSSAANGGGAKKRAKPAKKVAKKSKKEE-SDEDDDDESE 112
            ||:|||||:   :.|..|||.|.|.|.|||:||:| |:|:::||||
  Fly    69 KEYEANGGT---DSGAPKKRKKAAAKPAKKAKKKESSEEEEEDESE 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 44/62 (71%)
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 46/64 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449363
Domainoid 1 1.000 57 1.000 Domainoid score I3986
eggNOG 1 0.900 - - E1_COG5648
Homologene 1 1.000 - - H122817
Inparanoid 1 1.050 69 1.000 Inparanoid score I2470
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58872
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.