DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and HMGB2

DIOPT Version :10

Sequence 1:NP_726109.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_002120.1 Gene:HMGB2 / 3148 HGNCID:5000 Length:209 Species:Homo sapiens


Alignment Length:115 Identity:44/115 - (38%)
Similarity:71/115 - (61%) Gaps:10/115 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELW--RAMKDKSEWEAKAAKAKDDYDRAV 67
            ||||.||:.|:.:..|..||.|:||:.:.:.||:.||:|  ::.|||..:|.||||.|:.|::.:
Human    95 PKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDI 159

  Fly    68 KEFEANGGSSAANGG-----GAKKRAKPAKKVAKKSKKEESDEDDDDESE 112
            ..:.|.|.|.|...|     |:||:.:|..   ::.::||.|||:::|.|
Human   160 AAYRAKGKSEAGKKGPGRPTGSKKKNEPED---EEEEEEEEDEDEEEEDE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_726109.1 HMG-box_SSRP1-like 7..71 CDD:438810 26/65 (40%)
HMGB2NP_002120.1 HMG-box_HMGB_rpt1 8..76 CDD:438794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..150 24/54 (44%)
HMG-box_HMGB_rpt2 93..163 CDD:438795 28/67 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..209 16/48 (33%)
Required for chemotactic activity. /evidence=ECO:0000269|PubMed:19811285 165..180 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.