DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and Tox3

DIOPT Version :10

Sequence 1:NP_726109.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001386129.1 Gene:Tox3 / 291908 RGDID:1311529 Length:579 Species:Rattus norvegicus


Alignment Length:79 Identity:24/79 - (30%)
Similarity:45/79 - (56%) Gaps:2/79 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAM--KDKSEWEAKAAKAKDDYDR 65
            ::|::|:|||.|:....:.:||.:||.....||:|....:|.::  :.|..::.|...||.:|.:
  Rat   252 NEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLK 316

  Fly    66 AVKEFEANGGSSAA 79
            |:..:.|:..|.||
  Rat   317 ALAAYRASLVSKAA 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_726109.1 HMG-box_SSRP1-like 7..71 CDD:438810 19/65 (29%)
Tox3NP_001386129.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..258 1/5 (20%)
HMG-box_TOX-like 255..324 CDD:438811 19/68 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 472..492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 520..579
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.