DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and Hmgb1

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:XP_038945039.1 Gene:Hmgb1 / 25459 RGDID:2802 Length:486 Species:Rattus norvegicus


Alignment Length:110 Identity:45/110 - (40%)
Similarity:67/110 - (60%) Gaps:7/110 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWR--AMKDKSEWEAKAAKAKDDYDRAV 67
            ||||.||:.|:.:..|..||.|:||:.:.:|||:.||:|.  |..||..:|.||||.|:.|::.:
  Rat   366 PKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDI 430

  Fly    68 KEFEANGGSSAANGGGAKKRAKPAKKVAKKSKKEESDEDDDDESE 112
            ..:.|.|...||..|..|     |:|..||.::|:.:||::||.|
  Rat   431 AAYRAKGKPDAAKKGVVK-----AEKSKKKKEEEDDEEDEEDEEE 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 29/64 (45%)
Hmgb1XP_038945039.1 HMG_box_2 277..349 CDD:401091
HMG_box 366..433 CDD:395407 29/66 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100324
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.