DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and cmb1

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_593693.1 Gene:cmb1 / 2543595 PomBaseID:SPAC4G9.11c Length:223 Species:Schizosaccharomyces pombe


Alignment Length:75 Identity:21/75 - (28%)
Similarity:38/75 - (50%) Gaps:8/75 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKPKRPLSAYMLWLNSARESIK-RENPGI-----KVTEVAKRGGELWRAMKD--KSEWEAKAAKA 59
            |.||:|.||::|:....|.:.| |:..||     .:.|..:...:.|:.:.:  |..:..|:...
pombe   145 DVPKKPSSAFILFYKELRNNPKLRQELGIPEAISTLVEETQNASKAWKELAEDKKKPFIDKSKAL 209

  Fly    60 KDDYDRAVKE 69
            |:.||:.:||
pombe   210 KEQYDKFMKE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 18/70 (26%)
cmb1NP_593693.1 NHP6B 1..220 CDD:227935 21/75 (28%)
HMGB-UBF_HMG-box 147..218 CDD:238686 18/70 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.