DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and nhp6

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_593314.1 Gene:nhp6 / 2542878 PomBaseID:SPAC57A10.09c Length:108 Species:Schizosaccharomyces pombe


Alignment Length:97 Identity:29/97 - (29%)
Similarity:50/97 - (51%) Gaps:6/97 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAM--KDKSEWEAKAAKAKDDYDRAV 67
            |||.:||:|.:....||.:|.:||.....::....|:.|:.:  .::..:|.||.:.|:.|:|..
pombe    16 PKRNMSAFMFFSIENREKMKTDNPDATFGQLGSLLGKRWKELTSTEREPYEEKARQDKERYERER 80

  Fly    68 KEFEANGGSSAANGGGAKKRAKPAKKVAKKSK 99
            ||::    :..|||....|.:.||...|.|.:
pombe    81 KEYD----TKLANGEKTGKASAPAAAAAAKEE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 19/64 (30%)
nhp6NP_593314.1 NHP6B <7..>108 CDD:227935 29/95 (31%)
HMGB-UBF_HMG-box 16..81 CDD:238686 19/64 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I2031
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100324
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.