DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and SPBC28F2.11

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_595672.1 Gene:SPBC28F2.11 / 2540337 PomBaseID:SPBC28F2.11 Length:310 Species:Schizosaccharomyces pombe


Alignment Length:113 Identity:35/113 - (30%)
Similarity:56/113 - (49%) Gaps:17/113 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KPKRPLSAYMLWLNSARESIKRENPGIK---VTEVAKRGGELWRAMK--DKSEWEAKAAKAKDDY 63
            :||||.|||.|:..:.|..|| |:.|.|   |.||.|...|.|.::.  |:..:|.:|:|.::.|
pombe   116 QPKRPPSAYNLFQKNQRSEIK-ESLGEKSNDVKEVNKAMHEKWGSLSEDDRKTYEEEASKLREAY 179

  Fly    64 DRAVKEFEANGGSSAANGGGAKKR-------AKPAKKVAKKSKKEESD 104
            :..:..:.|    |..|...|..|       .||::.::..:||:..|
pombe   180 EEEMAAYNA----SKENASVADSRVTAEETSTKPSEDLSSPTKKDLID 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 25/67 (37%)
SPBC28F2.11NP_595672.1 NHP6B <108..251 CDD:227935 35/113 (31%)
HMGB-UBF_HMG-box 117..184 CDD:238686 25/67 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.