DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and Ubtf

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001349473.1 Gene:Ubtf / 21429 MGIID:98512 Length:764 Species:Mus musculus


Alignment Length:98 Identity:25/98 - (25%)
Similarity:50/98 - (51%) Gaps:7/98 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEWEAKAAKAKDDYDRA 66
            |:|||||:||..::....|..::.|.|.:..:|:.:....:|..:.:|.:.:.||.:|      |
Mouse   404 SEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKKAKYKAREA------A 462

  Fly    67 VK-EFEANGGSSAANGGGAKKRAKPAKKVAKKS 98
            :| :.|...|....:.|...:..|.|:::.::|
Mouse   463 LKAQSERKPGGEREDRGKLPESPKRAEEIWQQS 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 16/62 (26%)
UbtfNP_001349473.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
HMG_box 112..179 CDD:395407
HMGB-UBF_HMG-box 196..261 CDD:238686
HMGB-UBF_HMG-box 299..358 CDD:238686
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 370..411 5/6 (83%)
HMGB-UBF_HMG-box 407..470 CDD:238686 18/68 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 456..487 8/36 (22%)
HMG_box_5 479..562 CDD:373364 4/17 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 546..576
HMGB-UBF_HMG-box 569..631 CDD:238686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.